SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_015069m|PACid:19267366 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_015069m|PACid:19267366
Domain Number 1 Region: 107-222
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.36e-17
Family N-utilization substance G protein NusG, N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 285-333
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000321
Family N-utilization substance G protein NusG, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_015069m|PACid:19267366
Sequence length 338
Sequence
MKQGLLQWRSPCHCTHFLSPLSIPSVSIHISRTKHGPIQPITATVDSQQQQQLSARERRQ
LRNERREQKAGYSWREEVEERLIKKPKKRYTSKTEEMNLDTLADLGPRWWIVRVTRIRYE
ETAERLARSLARNFPDIDFKMYAPSVQVKKKLKNGSYSDKPKPIFPGCVFLRCVLNKERH
DFIRECDGVGGFVGSKVGNRIKQINKPRPVSVDDMEAIFKEAKEAQEQADQAFEEEQQRE
GTIKSENLNVESNTVTTVVTESFRDSKPKSQSGKASAKGNKLPAPGSTVRVVSGTFAEFL
GTLKKVNRKTRKATVGFTLFGKESLVDIDLSEIVPETN
Download sequence
Identical sequences V4USF2
clementine0.9_015069m|PACid:19267366 XP_006429259.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]