SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_018860m|PACid:19272165 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_018860m|PACid:19272165
Domain Number 1 Region: 122-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-24
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_018860m|PACid:19272165
Sequence length 265
Sequence
MVESKLTYEECRRQRMEENKKRMEELKLNVLARSLKTPVSKPSPVKKRVSKPKPASAPVR
RSSRVADKPPPNYNEDPFEPFLTRRRLTCRSYQRRNLLNRVYASDEERASAIDRADEVQS
GLDSQYPSFVKPMLQSHVTGGFWLGLPVHFCKEHLPHSDEIVTLVDEEENEFPTKYLAEK
TGLSGGWRGFSIDHELVDGDCLVFQLIKPATFKVYIIRVYVSEFNDDNNDVNKKNEKNNK
ENKEDSSARITRSAKRTRSSNLFKS
Download sequence
Identical sequences V4SGZ9
clementine0.9_018860m|PACid:19272165 XP_006423041.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]