SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_022140m|PACid:19278476 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_022140m|PACid:19278476
Domain Number 1 Region: 78-180
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.93e-27
Family Steroid-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_022140m|PACid:19278476
Sequence length 203
Sequence
MVAFFAAVMDTVTTYTGLSPAAFFTILALMCVVYKTVCSMFVDPEPPEDLKNKLISSSAA
ASAATAANFSNQTVIPETVQLGEVTEHELRAYDGSDPNKPLLMAIKGQIYDVSRSRMFYG
PGGPYAMFAGRDASRALALMSFDPQDLTGNIEGLSDSELEVLQDWEYKFMEKYVKVGQIV
SEQTSKPTKNGDKVPENQNHDGA
Download sequence
Identical sequences V4UQI4
clementine0.9_022140m|PACid:19278476 XP_006428529.1.91645 XP_006491794.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]