SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_026381m|PACid:19281786 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_026381m|PACid:19281786
Domain Number 1 Region: 21-98
Classification Level Classification E-value
Superfamily TSP9-like 2.09e-26
Family TSP9-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_026381m|PACid:19281786
Sequence length 98
Sequence
MASLPIISFAPATVRVYAATAAKEAGGSKEEKSLLDWILGGMQKQDQFYETDPILKKVED
KSPPSGRGTTNGRKNSASVPQPQKKKGGFGLGDLFAKK
Download sequence
Identical sequences A0A067FL29 V4RUC9
orange1.1g034302m|PACid:18111177 clementine0.9_026381m|PACid:19281786 XP_006425038.1.91645 XP_006488492.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]