SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_027064m|PACid:19270295 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  clementine0.9_027064m|PACid:19270295
Domain Number - Region: 10-45
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0549
Family N-utilization substance G protein NusG, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_027064m|PACid:19270295
Sequence length 76
Sequence
MILRSNRKKKTENFAPIKLRMKKKKEKKRERLLSNYVFAGISYTNRYSSSRFGFFYLINC
HIHYGVFQKILLLHLQ
Download sequence
Identical sequences V4V940
clementine0.9_027064m|PACid:19270295 XP_006435424.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]