SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_027617m|PACid:19251670 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_027617m|PACid:19251670
Domain Number 1 Region: 61-129
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0000235
Family Recombination protein RecR 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_027617m|PACid:19251670
Sequence length 257
Sequence
MESRPELASHCKKEDKGKNVYNEIEPKKTHLSGNDDGCKNNEKGAQENAENKENNDKNET
FWTVCPYCYYMYEYEKAFEEFCLRCQNCRRAFHGVAVVEPNKNMLVDGRDEYYSGLGYFV
LKYSLKRSKKKKESGDEGKTYNVGEVVEISDDSDEDDGGGVNAKSGNGAKEDVLKGNVKG
VMQESGNTEVINEEKRVVARKNVKSVPRNSKKVMGRGMKIRKIDGGSVRASGTGETDLEF
IEKDGDVYVGVKSIFDG
Download sequence
Identical sequences clementine0.9_027617m|PACid:19251670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]