SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_027628m|PACid:19256127 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  clementine0.9_027628m|PACid:19256127
Domain Number - Region: 200-299
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0628
Family B3 DNA binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_027628m|PACid:19256127
Sequence length 320
Sequence
MAEEEEFFSLLTLKDFEERGIDIGRKWTRLEALMAVASLASDKLEQESIIHKEKEKSTAS
CLDQGRVFECGSSSRSCNDSRTMLARVSDETAKEREKALKKPVTYYNLDFVDLYSKKGLQ
FSDNTPNKLLGDAMKARIWVAESEQKGSKSKRKLKREKENVLNVTPDDLPEQFRERIEQL
NGSKIGLVIQKHLYQAHLCDRQRRLSIPMNQIKSPDFLTDTEKRHLENKGEMKVKFIDPL
LQEYDSMIFKLRRMSKFDANKKEIACCLCYVFIKEWINVKNRNKLEFDDEIQLWKFRSPI
KNFVLCLGFIHIIIFGFTSR
Download sequence
Identical sequences clementine0.9_027628m|PACid:19256127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]