SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_028145m|PACid:19283677 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_028145m|PACid:19283677
Domain Number 1 Region: 76-179
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000068
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_028145m|PACid:19283677
Sequence length 189
Sequence
FLREAGEEAKGDEILKFFLQSWRLVRDLVGKRVAEVATLMETEERVVNVEMLYMPESLKN
RIIQEENGKDVVLVMSKKIGKTDLNKNDNRLLIPWGNLRDYSFLNQEEKSILDSQKGAKK
GIEVSVIPPSLESNVKLKLKKWKTGYCLTEKWHSLVVNNQENGLEMGVTVNLWSFRNNSS
ELCFALQKC
Download sequence
Identical sequences clementine0.9_028145m|PACid:19283677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]