SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_028259m|PACid:19257262 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_028259m|PACid:19257262
Domain Number 1 Region: 98-195
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000961
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_028259m|PACid:19257262
Sequence length 208
Sequence
MSSKEKSNNNYPEELKELGAAALALTCIKNTRLDNKAKATLHKLKTTYPGNSVREAASVI
AQNSSANSALDDEYKPPDIPPLVQNLRGVIGRCSKPMQKNLKNTDLNASQCRLLMNRASV
LEFLVPFLNEGECQTLKEGIQVTTYDLDGNAYTMSFKVWADKYYVLTSGWTKFHQDNGLT
DKHGLTLWMFRHVETQKLCSVISWRKVA
Download sequence
Identical sequences V4RI24
XP_006420388.1.91645 clementine0.9_028259m|PACid:19257262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]