SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_030317m|PACid:19278242 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_030317m|PACid:19278242
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-18
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 163-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000155
Family B3 DNA binding domain 0.012
Further Details:      
 
Weak hits

Sequence:  clementine0.9_030317m|PACid:19278242
Domain Number - Region: 122-179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0853
Family Pyruvate oxidase and decarboxylase PP module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_030317m|PACid:19278242
Sequence length 258
Sequence
MIPQEFVRKFGHELSAVATLAVPNGCVWRVGLTKDEGSIWFQNGWHAFVEYHSISAGYFV
VFRYRKNSSFQVFILDNLTYCGIQYPSRNSCTPPKHNGYEMQGEKPRMEGIEEKNQPDNM
NESMQDEIDIIKLLEDMRICVCESMKVLSVKERQAAIEAARSIKPEKPSFLVVLQTRNMM
EHVVYVPATFAQKYLSGDSHVVVQDSRGGSKLATEMKSSSGWLGFFEENHVTEGDILILE
MIKKKNKNILLKVSVVYT
Download sequence
Identical sequences V4SDL0
XP_006423680.1.91645 clementine0.9_030317m|PACid:19278242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]