SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031182m|PACid:19265459 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031182m|PACid:19265459
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000131
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031182m|PACid:19265459
Sequence length 140
Sequence
MAVYSKILTATDVSNQLEVKSSWINDLFPAFEAGQYHQDLVVEDEKGEKWEFVLRIRQKK
HKKPSISQATWHPFVVAKQAEVDDRVEFSRKTDGATGSACRYKIRVIKKVKKEVMENEGK
EVIKNEGKEVKLFGVIIGHA
Download sequence
Identical sequences A0A2H5QI01 V4SZT5
XP_006431365.1.91645 clementine0.9_031182m|PACid:19265459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]