SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031197m|PACid:19263908 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031197m|PACid:19263908
Domain Number 1 Region: 23-82
Classification Level Classification E-value
Superfamily DNA-binding domain 2.62e-23
Family GCC-box binding domain 0.0000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031197m|PACid:19263908
Sequence length 160
Sequence
MKASQGGGKNNERQRSVSVSEVRYRGIRRRPWGKFAAEIRDPTRNGTRLWLGTFSTAEEA
ARAYDRAAFAFRGHSAILNFPNEGQYRSQSSSGSSSLPYLVSPSPTSFSDATGGNGSAGR
GVLSSSSGKEAEVIEFEYFDNNLLEELLEARDNQYWPGKE
Download sequence
Identical sequences V4U4I2
clementine0.9_031197m|PACid:19263908 XP_006443851.1.91645 XP_006480088.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]