SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031394m|PACid:19269146 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031394m|PACid:19269146
Domain Number 1 Region: 50-142
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000373
Family B3 DNA binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031394m|PACid:19269146
Sequence length 147
Sequence
MVEKNESDDYDEFDLWASLEEMGMCIARKERTVTKEESRRAVKIARSLRPKIPSFMVILQ
SSDITHNAVYVPGKFANEFFSRDVKSIKIEDDKKREHTLSNNWRRNGGFVLLWAKLMRNN
SLQKGDICIFDFVPRNDFLLKLSVFSG
Download sequence
Identical sequences V4RPX8
clementine0.9_031394m|PACid:19269146 XP_006423233.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]