SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_031601m|PACid:19274986 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_031601m|PACid:19274986
Domain Number 1 Region: 185-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000141
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_031601m|PACid:19274986
Sequence length 315
Sequence
MGMPQKPIGVISQPQKKEPVKNQPESNHNLDNGSNNISSSSVVDGHDHDDGGFSSAGSRI
LMSVMSRSTPSQEPISRCSKFNKKRKHVQQVHQESSKKRTRKRDHSIVIINNDNSNEIST
KLSLRDETWPTKEDTTQAYIPAEDMMRNQMLAYNIGLMKYYRPGEEEHESRIGVSTKLDL
FTYPWSITKILTRSDLGHLSRLLVQTRLAERYVMPFLDEASRSEVIGNPEGLRVSVWDCD
TNSMHRLVFKKWATSNSYVLINHWTADFVRRRELAAGDEIGMCWDSFYSRFNFSVLKRAP
APTIIVQDHVDVAAS
Download sequence
Identical sequences V4U7L0
XP_006421994.1.91645 clementine0.9_031601m|PACid:19274986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]