SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_033196m|PACid:19265703 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_033196m|PACid:19265703
Domain Number 1 Region: 171-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-27
Family B3 DNA binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 48-104
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000183
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_033196m|PACid:19265703
Sequence length 295
Sequence
MEEDASSMVSNAKTNANNTEASDSNNSTSGLQPAPKRMRHGKNVSLVKFKGVVPQQNGHW
GAQIYANHQRIWLGTFKSEREAAMAYDSAAIKIRGGDSHRNFPWTDTNNQEPNFQNQYST
EAVLNMIRDGTYQPKFADYLRVQSQREDNNSNASLNQIMVHGDEQFAYRQLFQKELTPSD
VGKLNRLVIPKKYAVKYFPFISENAEENAINGGVDDMELVFFDKLMRPWKFRYCFWRSSQ
SYVFTRGWNRFVKEKKLKEKDIITFYACECANGAKEGQNFFLVDVIHCEGQNCNV
Download sequence
Identical sequences clementine0.9_033196m|PACid:19265703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]