SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_033388m|PACid:19266791 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_033388m|PACid:19266791
Domain Number 1 Region: 419-585
Classification Level Classification E-value
Superfamily BRCA2 helical domain 3.4e-40
Family BRCA2 helical domain 0.00056
Further Details:      
 
Domain Number 2 Region: 586-714
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-38
Family Single strand DNA-binding domain, SSB 0.00015
Further Details:      
 
Domain Number 3 Region: 718-747,865-950
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-25
Family Single strand DNA-binding domain, SSB 0.01
Further Details:      
 
Domain Number 4 Region: 748-865
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.2e-19
Family BRCA2 tower domain 0.0024
Further Details:      
 
Domain Number 5 Region: 956-1108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000006
Family Single strand DNA-binding domain, SSB 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_033388m|PACid:19266791
Sequence length 1112
Sequence
MSTWQIFSDADNNFKWQVSGRILQPEPNGSPIQPHSSSFRLPSMSDLLLEGHSKLPENGN
EGADNVSTPMFKTGSGKVVPLKQSSIEKALSVLGTDNDCGISFAGEEHPRENGFGFSNSL
FQTGSGKTVNISSAGLVRAKSLLGLEEGRNDWSFEGLQHTRMTSTPRFEVKEGVKGNVFE
SDTSVLRPSSISKAGFAESRFKNKISSNMMQTEGLNSAPKPPQIKFQTAGGRSLSVSTDA
LQYARNLLGDPELGTFFHEVDVDQLDLTSFKHRRFDDSSSNKENDVFTSFFRLGTAGTKT
ASKNFTSPLRLFSNPVRSRINSENINTSANLIEKFDAVDHDGVSGLNGKIPSVKKPIRST
HGHKAIMDNSVEDDIGSKINSLGRSSGKPLADITNSTSTACANIKQTCEKKRLLRSSISP
FKRPRISKFSTPLRTNLSSPNGLSTLSSEQSGCKKKVLSRYPYQIPRMSMKEYFGMPPSA
QGMLDHLQDQVRQMKSHNADKYMFHDASGLNCIGAEALFNMLAQSGASTQYASKLWVSNH
YKWIVWKLACYERCYLAKSAGKFLTVFNVLEELKYRYEREVNNGHRSAIKRILEGDALPS
SMMVLCISAIHMNCVPKIETHPEAQHGAENSYAAKLELTDGWYSVDAFLDVLLSKHLAAG
KLFVGQKLRIWGAILCGWVGPVSPLEASGSISLQLNINGTYRAHWADRLGFCKGFGAPLA
FRCIKSNGGPVPRTLVGVTRIYPVLYKERLSDGRSIVRSERMECKVMQLYQHRQSMVVEG
IVSEFQRGNKDSHILNDSNSEGAKLFKMLETVAEPEVIMAEMSPEQLTSFATYQAKLEAT
RQSNMERSIEKALENAGLRERDVTPFMRVRVVGLTGKNYQGKGSSREGIITIWNPAEKQQ
CELVEGQAYAILGLVPMNSDSNTLYLQARGSTTKWQPLSPLATEHFKPFFSPRRSVLISN
LGEVPLSSEFDIAAFVVHVGDVYEDSQQKKQWIFVTDGSMLELQLEDLSKSLLAISISSP
YIDDDSFSPINYNLVGSTVGFCNLIKRPKDHLNHIWVAEATENSSYFLSFDFPTCSHLRS
AAASAQSWAKISSLIIDKLKENVLFIIGDRKC
Download sequence
Identical sequences V4S5L3
XP_006429488.1.91645 clementine0.9_033388m|PACid:19266791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]