SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_033493m|PACid:19265018 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  clementine0.9_033493m|PACid:19265018
Domain Number - Region: 405-435
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0149
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_033493m|PACid:19265018
Sequence length 444
Sequence
DLELELLSKLKEPNLKNHIKCKSCSNLVSNFEQVKVMSQAVHLTAKSPPGYGPSEGRCLP
CLGVSGRAVAVSSCSSRGDFRILFQVKIGAVKYSSKGASFACRASSGSYRRNPDFSRQNR
NGYRGRNRQNEERDSIDDESELLSSRNGPILSLSNSPKFQATSTPGPREKEIVELFRKVQ
VQLRERAAAREDKKTESMQGQRKESETVDSLLKLLRKHSVEQGKRKSSSGSSNDFSLEQD
EPNGSHVEDKSTSFFDSSSRARTESREPNVSSFTRPASNFRRRSPVTQFKYQPVYSSDET
ENSVSRLDSSGKGKKSSLEIHTDPKRESESEPELETEPEASFADGEVYDEASDVESNVIT
DGSLYDEVLENEPNIIDDSVYRVSEEGESSDNDEDENKQEEIENGDLSALKLPELRALAK
SRGVKGFSKMKKAVLLELLAGSSV
Download sequence
Identical sequences clementine0.9_033493m|PACid:19265018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]