SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_033898m|PACid:19252715 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_033898m|PACid:19252715
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-17
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 192-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-16
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_033898m|PACid:19252715
Sequence length 290
Sequence
MIPPLFAIKFGHELTNAATLTLPNGRQSQVSLKKDGRNVWFRDGWHEFVEIHSITPGYFL
VFKYEKNSRFRVHIFDTTACEIKCPCMSEESENVKDEMVDSEDCVEISKRLFAQKSLKWN
CKFGASLENSKVKYKCDPGSKKRKKEELAEKNESDELDLCDSLGEMGIYVSKRCRISAEG
KKRAIRIARLLKLKNPTFMVILLPRDKHYAYVPAKFANEFFSRDAQSVKVQVLNETERSL
HIHWRHKGGFFLSKGWAELSKDKKLAEGDICVFQLIRKEDVLLKLSIFHA
Download sequence
Identical sequences V4SC07
XP_006423120.1.91645 clementine0.9_033898m|PACid:19252715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]