SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_034838m|PACid:19270881 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_034838m|PACid:19270881
Domain Number 1 Region: 219-254
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000432
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_034838m|PACid:19270881
Sequence length 256
Sequence
MGANSFYPQPLLFLNKQLKPGTPVLSLRVCFLNLTEIAYWPSPFGIQKNPCKFTYLSIRA
DGSRGNRTPLNGYAAGRTKNGDGNESSQSSDGKVSSSSNNEAIISLVGRIKSSISKREAV
RTKKRNPSSSDKPKVQSVSDVLFQPRKEVKVIDTRSIKDVPKEEQKIQDNEPVADIKLSR
LPSNFVKRSPIPSPSAPRDKRVLNYEPSASKESTKHLELPRVEELKLPQLKELAKARGIK
GYSRMKKSELINKLRS
Download sequence
Identical sequences clementine0.9_034838m|PACid:19270881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]