SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_035630m|PACid:19266165 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  clementine0.9_035630m|PACid:19266165
Domain Number - Region: 32-142
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000137
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_035630m|PACid:19266165
Sequence length 152
Sequence
QAAIASGKPYEVTRTIVEMRDFGNPPQFDPKNPWQIRKSVTGSDVYNGKLVLSHYEFFDH
VFRYWTLDLCNYVDQGNQYSVTIADYTDERNPKRFKSENIFVQGNHGIFFLGWTDVVQSR
HLLPGDEIGLFWDVSSSNFGFKLLSRGNSHKN
Download sequence
Identical sequences V4SKZ7
clementine0.9_035630m|PACid:19266165 XP_006428087.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]