SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_000468m|PACid:19267148 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_000468m|PACid:19267148
Domain Number 1 Region: 497-714
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000124
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 2 Region: 698-934
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000569
Family Tropomyosin 0.0019
Further Details:      
 
Weak hits

Sequence:  clementine0.9_000468m|PACid:19267148
Domain Number - Region: 323-565
Classification Level Classification E-value
Superfamily Tropomyosin 0.0445
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_000468m|PACid:19267148
Sequence length 1377
Sequence
MEEETQVGSEVPVMKAVEDIDPIKETNGGLPQVGKEGKKEEEENALDAEFIKVEKEALDV
KEVSHMAEPAAAEEDDKPSVVDRSSSSSSRELLEANEKVKELEIELERAATALKNAEIEN
ARLQDDVLVSKEKLEESGKKCAELEIGQKKFQEQIVEAGEKYNSELNAMKEALQAEEAKR
KELAEVKEAFDGLSLEIEQSRSRLPELEHKLQCSVDEARKFEELHKQSGSHAESESQRAL
EFERLLETANVSAKEVEGQMASLQEELKGLNEKISEKEKVEEELKRSNTEISAIQEELGL
SKLQLLDLEQRFSSKEALITNLTQELDLIKASESQAKEEISALDNLLADAKENLHAKVSE
LEDIKLKLQEEVNARESVEAVLKTQEAQVSNVNEELDKVSKEKEALEAAMADLTGNIARM
KELCSELEEKLRNSDENFCKTDSLLSQALANNAELELKLKSLEEQHNETGAAAATASQRN
LELEDIIRASNEAAEEAKSQLRELEPRFIAAEQRSVELEQQLNLVELKSSDSEREVREFS
EKLSQLSTALKEVEEEKKQLHDQMNDYKDKITQLELTLNQSNTRSSELEEELRITKERSA
EDEDRANMSHQRSIELEDLFQTSHSKLEGTGKRVNELELLLEAEKYRIQELEEQISKLEK
KCEEAEAGSKQYSDKVCELASELEAFQARTSSLEVALQMANDKERELTESLNAAADEKRK
LQDTSNGYNEKLAEAENLLELLRNDLNMTQERLESIENDLKAAGLRETDVMEKLKSAEEQ
LEQQTRVLEQATSRNSELESLHESLMRESEMKLQDALANITSRDSEAKSFSEKLKNLEGQ
VKMYEEQLAEAAGKYALLKEELDSYFIKVTSLESTNEELQRQVVEANNKANNSSSENELL
VETNNQLKSKVAELQELLDSAISEKEATGQQLASHMNTVTELTEQHSRSLELHSATEARV
KEAEIQLHEAIQRFTQRDIEANNLNEKVNVLEGQIKSYEEQAREASTVAETRKFELEETL
LKLKNLESTVEELQTRSGHFERESGGLVETNLKLTEDLALYETKLSDLQAKLSATIVEKD
ETVEQLHASKKAIEDLTQKLTSEVQGLQTQISAIMEENISLNETYQNAKNELQSVISQLE
AQLNEKKATEETFKSEIESLKAQAAEKFALKTRIKELEELLVNVETQFKEEVENVKVSAA
GKEAELNSQLEDHAHEVKDRNALYEQVIQLQRELQIAQTAIAEQRGADSQKDSEREAALK
SSLEELGAKNKEAALLQNKVAELEQKLQQAQAKLKQGSEDTPSEVKDAAEIKSRDIGSVI
STPSKRKSKKLEAAAQTSSTREIPTARAVASPVMTFKFIIGVALVSVIIGIILGKRY
Download sequence
Identical sequences V4SQM8
clementine0.9_000468m|PACid:19267148 XP_006429767.1.91645 XP_006481365.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]