SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_000886m|PACid:19278511 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_000886m|PACid:19278511
Domain Number 1 Region: 15-559
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.3e-91
Family Acetyl-CoA synthetase-like 0.0000182
Further Details:      
 
Domain Number 2 Region: 752-1119
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.86e-34
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 577-635
Classification Level Classification E-value
Superfamily ACP-like 0.0000317
Family Peptidyl carrier domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_000886m|PACid:19278511
Sequence length 1124
Sequence
MNKGSGRENQQEREQHCCISHEFLRAANCNPDKIAVIHAAASPSDRKLINGSPSSSYNPP
VYEGDGRFTFSEVLASVDSLSSRLRSILDHSDDPHLILPLTSAAEFINAYRPKIIGVYML
PSVEYIISVLSILRIGEAFLPLDPTWPKDRILSVISSSNVGLIIACGSSFNESGIGYYLL
DKSHWLIESGICPVLCFSMEERVEDTIGRSNIVCHCENERQRSFCYLMYTSGSTGKPKGV
CGTEQGLLNRFLWMQDLYPLHGEELLLFKTSISFIDHLQEFLSAILTACTLVVPPIIELK
KNLISIIHFLQAYSISRLTTVPSLMRAVLPALQSQHNVHVRSSLKLLVLSGEVLPLSMWG
IISKLFPKISILNLYGSTEVSGDCTYFDCKRLPSILEMNTLESVPIGLPISNCDIVLVKL
HNNSICNCSVSCGSQMYFRTGDFARRIQSGDLVFLGRKDRTIKISGQRMALEEIEHTLRG
HPDVVDTAVVSHKHQGELVILEAFIVLKEKKTSSEAFVSSIKSWVSNKLSLAMIPSRFVF
MDSLPMTSSGKVDYASLSASTSFTIPAQHDADETKASDLLQVIRKAFGDALMVEEVLHDD
NFFIMGGNSIAAAYVAHSLGIDMRLIYNFPTPSKLEIALLEKRELCNLDVSADANWKLNR
EEDKEHQFHSGYSPTENHAVVSKRLKVNSNKYFKPELNHDKDGFPWNLSSVPMSCSFSRC
NKVMHEEKFRGNALCHVNWSIEAPRNKRGFIQELWKVHMESCVDASPLVVLKDSDIYLFV
GSHSHKFICADAKRSSVLWEIKLEGRIECSAAVLSDFSQVVVGCYKGKIYFLDSLTGDIY
WTFQTCGEVKCQPLVDAPRQLIWCGSHDHNLYALDFRNYRCVYKLPCGGSIFGCPAIDEV
HNVLYVASTSGRLTAISVKALPFHTLWLHELEVPVFASLCITSASRYVICCLVDGHVVAL
DSSGSIIWRCRTGGPIFAGPCTSFALPSQVKHHLQALVCSRNGSIYSFEQESGNLLWEYG
VGDPITASAYIDEHLQLKSESSLSIDRLVCVCTSSGSIHILRVNLDVTRKENQSKDPMVQ
EFAKRELQGDIFSSPVMIGGRVFVGCRDDYIYCIALETQRLEEE
Download sequence
Identical sequences clementine0.9_000886m|PACid:19278511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]