SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_001088m|PACid:19253601 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_001088m|PACid:19253601
Domain Number 1 Region: 78-344
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000997
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 304-472
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000621
Family Tropomyosin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_001088m|PACid:19253601
Sequence length 1060
Sequence
MKNCDNNKEELRLAESKKEILRRSYDLAHAQANSVLNFTVQWKDLEEHLDISMKSLEKQS
NDVDSKIRLLDQCAKEIESKESDLVLAERRIKECNFELACKEKQLELVQKRIGECECELQ
LKEGELNLVKKSVEEWLEKLNLKMEEVGLVEKSNDKSLVDQRRLENLIKDFCEQIELKEK
DLRKIRSSIEECEKELVMKEKHASSLQSLIEDYAEELESKEKLYDEIKKSIIQCETKLDC
KKKELELTQTSIIELSLELHLEEEKLESLQRIVRLRENELDSKEEKLDSMKEEMKKYFND
IELKEREFNGIRKCIEKRSQELTLKEKQLKCVQESLEGCRNEFEEKENELISVEKLIDKC
SEELELKKKHLCVIENSAAELSDECESNELELDLIQTMAIGYLKQLKEKEKQFHSLKEAL
DERWQDLEIKERKFEERVKEFELREKEIESIRKAVEDRSKNLELKEKKLSNNLHLQVKIE
QPESLKGNEGTKQLSLQSCTMITGKNLQLLLNQHLQKHDLVFGEISHTLTKACDPASLVL
DAMEGFYPPHSREGDMEFDVSIIRRTCILLLEQLSSVTPEINPQVRDEAMKVAGEWKKKM
RVAEDNSLEVLGFLHLLAAYGLGPSFDGIELESLLDIVAQHRQTSKLRQSLGFAEKAHGL
QCSTTREARSCLSLLNKHDLGHNEVLQLLHLAPDPAMFVLDFIHHWKSQGAGFEEDNVKC
CILVLEKLKEVLPIINPRVKGEAMKLAVEWKTKMGVGTLNSLEVLVFLQLLGTFELVASF
NRVEIVELLWTISEHKQAPETCRALGFTDIVANFVRNLIGRKKHIAAIRFICAFKLTDIA
KPEAIFKQYLDDNISDIHRKGNNSSDAKVKAMDFEVNALTFLIECFKENKLESSLLIENI
KQRIVQLEMAKADCRRHSTPAPSATIQLQLASRNNYNIGTSTPTNQPVPSHTNQPQHSGI
NHSIGFSASREQPQLQNNYKRPRIEPLTTRAYMPQIPASVNLHRSSPTMQHGPGVALSGG
QMQFDHIASNHLRVRANMGAGQTSNVTGNQNLHHFQYKYF
Download sequence
Identical sequences V4T9Y2
XP_006433136.1.91645 XP_006471810.1.29302 clementine0.9_001088m|PACid:19253601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]