SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_002219m|PACid:19267552 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_002219m|PACid:19267552
Domain Number 1 Region: 264-366
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.72e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  clementine0.9_002219m|PACid:19267552
Domain Number - Region: 24-62
Classification Level Classification E-value
Superfamily YfgJ-like 0.0275
Family YfgJ-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_002219m|PACid:19267552
Sequence length 856
Sequence
MESRTCMNGKCRASSSIEWRKGWPLQSGGFAVLCDKCGSAFEKLIFCDEFHSKDSGWRKC
ASCSKIPGDDPNGFGTLKTDNAGDLPSTSVDNQLGGSDDKFKLLQLGNSSESVGLRHLLQ
FRNDDLDGSFRKVKPEEAAKSDISKANIGAKDIYGPLAHTNLSITLGSPGINSNSFPSAV
VDEKEHSKTSAIIHQGPKSRHLLPKPPKLALATGSEANAGISQIRVARPPAEGRGRNQLL
PRYWPRITDQELQQLSGDSNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPE
GLPLRIQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKL
VMGFRKASNAVSVQDTQPSAIPNGGHSSESFFSGVFENLSILSGYSGVLQSLKGSTDPHL
SSLSKQLNSPPGDINWVKSEKHEDKTREGLLPPSMLVPERKRSRNIGSKRKRLLIDRLDV
LELKLTWEEAQDMLYPPPSVMPSIVTVEDHVFEEYEDPPVFGKRSIFIVRTSGGQEQWAQ
CDGCSKWRRLPVDVLLPPKWTCMDNVWDHNRCSCSAPDELTPREVENLLRLNKDFKKRKI
ATSHRLNQEHEPSGLDALSNAAILGENMGDPGTASVATTTKHPRHRPGCSCIVCIQPPSG
KGKHKPTCTCLVCMTVKRRFKTLMMRKKKRQSEREEEVAQRNQPTWGPKEEAEVDSSSKH
VSSHLDPSENEARSANELESKGQNNNLSGKLAESSKAELDLNCHPEREEAQAGLNRVSMM
KLLQVASHPLETYLKQNGLTSLTSDQQASSGTLAPPQAAGESEGQLNELASATQERESGG
EDNCEPVSDQIPDDPE
Download sequence
Identical sequences XP_006481192.1.29302 clementine0.9_002219m|PACid:19267552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]