SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_003300m|PACid:19271042 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_003300m|PACid:19271042
Domain Number 1 Region: 150-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_003300m|PACid:19271042
Sequence length 743
Sequence
MVGLIDLNTTEDDENPSSGSLSPSSSSASALSASGFALAPASASASGVSLELWHACAGPL
ISLPKRGSVVVYFPQGHLEHVSDFSAAASAAYDLPPHLFCRVADVKLHAEAASDEVYAQV
SLVPDELIEQKVREGKIEEDGDEESVEVVAKSSTPHMFCKTLTASDTSTHGGFSVPRRAA
EDCFPPLDYSQQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGD
AVLFLRGEDGELRLGIRRAPHVKSGATFPSFCSQQSSPNSVTEVVDAIARKRAFSISYNP
RASASEFIIPVNKFLKSLGHSFAVGMRFKMRFETEDAAERRYTGVIMGVGDMDPVRWPGS
KWRCLLVRWDDVESNRHTRVSPWEIEPSGSVCGSNNLITSGLKRTRIGLPSGKPEFPVPD
GIGVTDFGESLRFQKVLQGQEILGFNTLYDGGDCQNLHPSEVRRGIPGSNGSGIAAIGDG
SRNLQVKSDISYKGIGIGFGESFRFHKVLQGQEIFPKSPYGRAPTNNEARSIGSLGISDG
VPVSGSRNRWSAVVPGYNTHMSPSAPPVQVSSPSSVLMFQLASNPISNYNPPYSLNDQEK
EQRVNCQSFFHNSEIYGGKHASSSFLDHSFVGGDQEVMDSIGQSNEHISPPLVGQPTVRG
SQDLVSSCKGSCRLFGFSLTEERHVANIEDNAAPVASPLNPRSSFLSHVGQQFHPKPPVM
SKATGSNCTNGIMQHCLGNYDIY
Download sequence
Identical sequences V4UET9
clementine0.9_003300m|PACid:19271042 XP_006449420.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]