SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_003491m|PACid:19264225 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_003491m|PACid:19264225
Domain Number 1 Region: 580-676
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.51e-21
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_003491m|PACid:19264225
Sequence length 727
Sequence
MKNLQLYGEDLHVRSKIEANNHTGFQAMTEEQVTGAGAEREIYMQDDLLDVDDASIFYAD
FPPLPDFPCMSSSSSSSSTPAAVKAITSSASSSSASSSSSAASWAVLRSDAEEDVDKKNH
QDQSGDAATQPALSSTASMDISQATDTGINGVGVDCMDVMENFVFMDLLDNNDLFDPSSI
FNQDDSQPFEGYQQQQQQNQPQHEHRQQERDQELMMQSNNGDNSNEDGGASDDLAMVFLE
WLKSNKETVSAEDLRNVKIKKSTIECAAKRLGGGKEAMKQLLKLILEWVQTNHLQKRRMR
EALLPASNNNNNLPHQQHFQDTFQNPNPNPNPNHIPNPNLNCNPIPPEPNPCFAQSSWIG
QPSFIHDPATMVTGFPTPAVGYMGDSFANGMSNINGHGYAAPPSEYHMLETTRSWPNSQF
GLASNYNSFSDNNLHPAPLHPQAFTGYGNQYPYPYLPGHGEQRLMRMGSSATKEARKKRM
ARQRRLSTHPRHQHHHNNQQNQLQGQNADQHARFGSDNCNPAAQANSGNWVFWPASAGGP
AAVSPLSPVDRQPMQPQNYQRQPASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPK
KEAETHLPELEARDGISIAMEDIGTSRVWNMRYSFRFWPNNKSRMYLLENTGDFVKANGL
QEGDFIVIYSDVKCGKYLIRGVKVRQPGPKSETKRTGKSQRNQHANPPSAAMGNGSSSSL
QVPQTVK
Download sequence
Identical sequences V4T9C6
XP_006443663.1.91645 clementine0.9_003491m|PACid:19264225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]