SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_003806m|PACid:19280466 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_003806m|PACid:19280466
Domain Number 1 Region: 114-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-29
Family B3 DNA binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  clementine0.9_003806m|PACid:19280466
Domain Number - Region: 620-691
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00589
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_003806m|PACid:19280466
Sequence length 703
Sequence
MITFMDSKEKLKEVEKCLDSQLWHACAGGMVQMPPVNSRVFYFPQGHAEHACGPVDFRSC
RRIPPYILCRVSAIKFMADPETDEVYAKIKLVPVSNNDPDFDNDDGIAGIHSNETQDKPA
SFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTILAKDVHGETWKFRHIYRG
TPRRHLLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGPEVTSGWNGN
CVTPYGGFSAFLREDDNKLMRNGIGNVNGPSSNNGNNLMAKGKVRPESVIEAATLAANRQ
PFEVVYHPRASTPEFCVKASMVKAALQIRWCSGMRFKMAFETEDSSRISWFMGTISSVQV
SDPLYWPDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPPRKKSRLPQ
PPDFPLDGQLPMPSFSGSLLGPNSPFGCLPDNTPAGMQGARHAHYGLSLSDLHLNKLQSG
LSPAGFPPFDRAAKPTRASNSPILQKPSMSENISCLLTMSHSTQPSKKADDLKTPQLVLF
GKPILTEQQMSHSCSGDTVSPVRTGNSSSEGNLDKLTNFSDGSGSALQQQGLPDRSFCEV
FQWYKDNRQETEPSLETGHCKVFMESEDVGRTLDLSLLGSYDELYKKLAEMFGIENAETL
SHLLYRDVTGAVKHIGDEPFSDFMKTARRLTILMDSGSDNVGV
Download sequence
Identical sequences V4SMW1
XP_006428777.1.91645 clementine0.9_003806m|PACid:19280466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]