SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_003933m|PACid:19256371 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_003933m|PACid:19256371
Domain Number 1 Region: 120-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_003933m|PACid:19256371
Sequence length 694
Sequence
MITVMDSAKDAMKKNPTGESCLDSQLWHACAGGMVQMPQINSKVFYFPQGHLEHAKGNVE
LPNFNIPSMIPCRVTAIKFMADAETDEVYARIRLIALKSNGFDDFEDVGFDGNGGIGNES
SEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTILAKDVHGEVWKFR
HIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKKGGIGGGSDYS
VGWNSGGGNCGFPFGGYSGYMREDENKSSRRNSSSDLRGRVRAESVTEAAALAANGQPFE
VVYYPRASTPEFVVKASAVRAAMQIQWCSGMRFKMAFETEDSSRISWFMGTISSVQVADP
IRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVSNIPAIHLSPFSPARKKLRLPEHSD
FSLINQLPTPSFTRNPLVTSSPFCCISDNIPAGIQGARHAQYGLSSSDLHFNKLQSSLFP
LGFQQLEHTTRPARVSSANFMSETGNSKNISCLLTMGNPTQSFKDNIEVKTPHIILFGQL
ILPQQNSSQSCSGDTIVNSLSDGNPEKTAISSDGSGSAVHQNGPLENSSDEGSPWCKDHK
KSDLGLEMGHCKVFMESEDVGRTLDLSVLGSYEELYGKLANMFGIESAEMFSNVLYRDAA
GSVKHTGDEPFSEFLKTARRLTILTDSGSDSVGR
Download sequence
Identical sequences A0A2H5P2B1 V4SPI5
clementine0.9_003933m|PACid:19256371 XP_006436433.1.91645 XP_006485698.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]