SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_004095m|PACid:19253099 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_004095m|PACid:19253099
Domain Number 1 Region: 192-488
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.62e-99
Family Cryptochrome/photolyase FAD-binding domain 0.0000000000305
Further Details:      
 
Domain Number 2 Region: 7-174
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 6.28e-49
Family Cryptochrome/photolyase, N-terminal domain 0.0000000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_004095m|PACid:19253099
Sequence length 681
Sequence
MSGRGCSIVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGPYYPGRVSRWWLKHSL
SHLDSSLRSLGTSLVTKRSTDSVSSLLEVVKATGATQLFFNHLYDPLSLVRDHRAKEALT
AQGIAVRSFNADLLYEPWDVNDAQGQPFATFAAFWEKCLSMPFDPDAPLLPPKRINSGDM
SRCPSDTLVFEDESEKGSNALLARAWSPGWSNADKALTTFINGPLIEYSKNRRKADSATT
SFLSPHLHFGEVSVRKVFHLVRIKQVSWANEGNKAGDESVNLFLKSIGLREYSRYMSFNH
PYSHERPLLGHLKFFSWVVDEGYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSS
FFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGTIPDGRAFDRIDNPQFEGYKFD
PNGEYVRRWLPELARLPTEWIHHPWNAPESVLQAAGIELGSNYPFPIVRIDAAKCRLDEA
LSEMWQQEAASRAAIENGTEEGLGDSSDSAPIAFPPDIQMEEIPEPARNNLPTTARRYED
QMVPSMTTSLVRVEEEESSLELRNSAEESRAEVPRNANVNQEPRRDTLNQGVLQTVHNNN
AFQQFNAAIVLANAEDSTAESSSTSRRERDGGVVPVWSPATSSYSEQLVGDENGIGTSSS
YLQRHPQSHQIMNCRRLSQTG
Download sequence
Identical sequences A0A067GZR5 V4V5H1
orange1.1g005710m|PACid:18108461 orange1.1g005723m|PACid:18108459 orange1.1g005725m|PACid:18108460 clementine0.9_004094m|PACid:19253098 clementine0.9_004095m|PACid:19253099 XP_006433984.1.91645 XP_006433986.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]