SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_004125m|PACid:19286945 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_004125m|PACid:19286945
Domain Number 1 Region: 113-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-48
Family B3 DNA binding domain 0.0065
Further Details:      
 
Weak hits

Sequence:  clementine0.9_004125m|PACid:19286945
Domain Number - Region: 627-679
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000209
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_004125m|PACid:19286945
Sequence length 679
Sequence
MKLSTSGLCQQGHEGDNKCLNSELWHACAGPLVSLPTVGTRVVYFPQGHSEQVAATTNKE
VDSHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKDTFVPIELGIPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAIRPPTVMPSSVL
SSDSMHIGLLAAAAHAAATNSCFTVFFNPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRM
LFETEESSVRRYMGTITGISDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSLFPLRLKRPWHPGTSSFNDNRDETGSGLNWLRGGTGEQGLTTLNFQSLGMFPW
MQQRVEPSFLGNDHNQQYQAMLAAGMQSGDPVRQQFMQLQQPFQYLQQSGSQNPLQLKQQ
QVIQQSIPHNLLPAQSQILTENIPQHLLQQLNSQAEDRAQQQQQPQQHMYHDALQIRTDE
LLQRQQSNLPSPSFSKANFMDSSTEISVSISPMQNMLGSLPEGSGNLLNFSGAGPSMLRQ
QFPQQSLGSKYEPSQVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQ
LVFVDRENDVLLLGDDPWE
Download sequence
Identical sequences V4SSI8
XP_006430417.1.91645 clementine0.9_004125m|PACid:19286945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]