SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_004698m|PACid:19257577 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_004698m|PACid:19257577
Domain Number 1 Region: 194-488
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.57e-101
Family Cryptochrome/photolyase FAD-binding domain 0.000000000999
Further Details:      
 
Domain Number 2 Region: 6-175
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 5.1e-49
Family Cryptochrome/photolyase, N-terminal domain 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_004698m|PACid:19257577
Sequence length 644
Sequence
MGGNRTIVWFRRDLRIEDNPALAAAARDGSVFPVYIWCPKEEGQFYPGRVSRWWLKQSLS
YLGQSLKSLGAELVLFKTESTLAALLECISAIKATKVVFNHLYDPVSLVRDHSIKEKLVE
LGISVQSYNGDLLYEPWEIYDERGHAFTTFDAYWDKCLQMQMEPASILPPWRLVQAAGTI
DGCSIEDLGLEDESEKSSNALLGRGWSPGWSNADKVLTEFVEQHLLRYYKNRQKLGGNST
SLLSPYLHFGELSVRKVFQCLWMKQILWAKEENFEGKESVTFFLRAMGLREYSRYLCFNF
PFTHERSLLSNLKYFPWHADLGNFKAWRQGRTGYPLVDAGMRELWATGWIHNRIRVIVSS
FAVKVLLLPWRWGMKYFWDTLLDADLECDILGWQYISGSLPDGHELERLDSPEIQGSKFD
PEGEYVRQWLPELARMPTEWIHHPWDAPPNVLKAAGVELGLNYPKPIIDLDLGRERLTQA
IFKMWEMEAADNATDSNGTNEVVFDNSDRIQTPAIPQVVLREKSTCPTISSNDQKVPSFQ
NGKNNLPSRKRPKNVEEERQYPDELYSCKNEAGNSGAHDDFCSTAESSATKRQTTTNISF
SVPHSFSLSDGKALQEYQSSDVNRPWQEQIDREQNSSNDGAMRY
Download sequence
Identical sequences V4U2K0
XP_006420219.1.91645 clementine0.9_004698m|PACid:19257577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]