SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_004743m|PACid:19264442 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_004743m|PACid:19264442
Domain Number 1 Region: 70-196
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-35
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 547-620
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000353
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_004743m|PACid:19264442
Sequence length 642
Sequence
MEQVEAYNSQDDKAELPIYNLPPKILCEVVYAQLKAEPGTDEVFAQITLLPRPEIDELSL
EVGNSPPLPPKLNVCSFSKKLTPSDTSTHGGFSVPKRHADECLPPLDMSKDPPLQELVAK
DLHGLEWRFRHIYRGQPKRHLLTSGWSVFVTSKKLVAGDVCIFLRGGDGELRVGVRRAMK
LQNNASTSVISSLSMQHGILAGAFHAISTGTRFTVYYHPWTRPAEFLVPFSQYMKSAEID
YSIGTRFRMVFEGEECADQRIAGTVVGTEDVDHIRWPASEWRCLKVKWDATTDSITRPAR
VSPWNIEPIERTHKRPASVQHQQKRLRPNDASSPWFSSLFRVFQGQENRVTGVKALGAAK
TPLLPSLVRPPNPVWAQMQSGLENKLKFPMHDPFYMCLNRMVSLPGGSLMSPGLSNHWPA
SPFAPYEVCETAAQSKNLSVPNASSENSGSQMCMALELKDENRTPLAQPNGGSRYMLFGV
NLVNSPPELPSPQMATSNELESPCSVPPTSQSSISETIQVSEPSKSVSGILSEKQCKNCY
VSRSCTKVIKFGTALGRSVDLTRFHGYDELISELDQMFDFNGSLIDGNSGFHIAYMDDEG
DMMLVGDNPWQDFQCAVRRMFICPKEDIDGVIPSSPNPTPPQ
Download sequence
Identical sequences V4U089
clementine0.9_004743m|PACid:19264442 XP_006444215.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]