SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_005201m|PACid:19279381 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_005201m|PACid:19279381
Domain Number 1 Region: 299-401
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-16
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 81-215
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000157
Family BTB/POZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_005201m|PACid:19279381
Sequence length 616
Sequence
MENANEKSASLSFVSSYPTCWSTNQSTDTCDLDDLNMVLDGIMENANEKSASLSFVSSNP
TCWSTNQSTDTCDLDDLNLRMQSSNPKETWHDAEIVVEGKSVAVNRSILSERSQFFRRLF
NLRNDGSVSEGKPKYLLTDLVPHGKVGYEAFNDTLHYIYTGKTKAPPPEVSTCVDDACVH
VSCPPTINYVIELMYASAALQMKKLVIRLELWLLNLVEKALVEDVIPILVAALHCQLNHL
RSFCIQRIAKSNLDNVCLEKELPDEVSSEIKSLRVKSNQESEANIAEVDPMHAKIVRRIH
KALDSDDVELLKLLLDVSNVTLDDAYALHYAAAYCSPKVFKEVLNMDLACLNLKDARGRT
VLHVAARRNEPEVMVTLLSKGACASETTSDGQTAVAICRRMTRLKDYLEATKQGQGTNKD
RLCIDVLEREMRRNSMSENLAMPSEVMDDDFQAKLDYLENTVAFVRLFPSEARVAMEIAG
ADTATGLSALGQKGLSGNLKEIDLNETPSMQAKSRQLRLLTLLKTVETGHLYFPHCSEVV
VKFIDCYSPHCSEVVDEFLDCDWSDASLLEKGTPEEQILRRAYFMKLKEDMQEALCKDVA
YHRHSGLPSSCGTRKR
Download sequence
Identical sequences clementine0.9_005201m|PACid:19279381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]