SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_005587m|PACid:19279325 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_005587m|PACid:19279325
Domain Number 1 Region: 268-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.57e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 48-193
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000434
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_005587m|PACid:19279325
Sequence length 595
Sequence
MVLDSIMENANEMSSSLSFASSSYLSNGSTNHPASPELCSSLDNLSLSKLSSNLEKLLLD
AEYDYTDAEIVVEGKSVALHRCILSARSQFFHELFKKGNNNDGSAVSEGKPKYLMTELVP
YGKVGYEALNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQM
KELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKEL
PDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTL
DDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGA
CASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLAL
SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGN
LKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGT
PEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLSSSSSSSSSPKEGVKCKGRKR
Download sequence
Identical sequences V4TKK9
clementine0.9_005587m|PACid:19279325 XP_006437091.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]