SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_006512m|PACid:19274447 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_006512m|PACid:19274447
Domain Number 1 Region: 427-528
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-23
Family B3 DNA binding domain 0.0082
Further Details:      
 
Domain Number 2 Region: 209-307
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-22
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 3 Region: 13-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-19
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_006512m|PACid:19274447
Sequence length 554
Sequence
MDNQPGMLYFRRPCFFNIFSSNLSAECLKLPLQFVRHMEGRTSGSVTLIGPSWDTWHIDL
IQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAFNSKSTS
TGQKREREEAVAHSDKALQSLLKKIRECSSSFESDCIDDNRDREADSCEETRRCLSLSTI
FASPSQPKTCNIKPEDEEKKVAQSFISAFPYFVRKMKRFNVSGSYTLNIPYQFSMAHLPN
FKTEVVLHNLKGASWTVNSVPTTKVHTSHTFCGGWLAFVRGNEIKLGDICIFELVHKCEL
HVYILRVGKQYPDSQRGTTVLTGSNVSSTTISCKQFDGVPKKVKKNSLKKIQLCNVKGSK
SCEIKKHIGTDGNSVSIATCCLPKISHEKSEAAAQNRNNVEAKMDSTPGGNLRTMMALDE
EKAARSFNSCVPHFVRIMRKFNISGSYTLKIPYKFAMAHLPDCKTEIVLRNLKGECWTVN
SLPDSKGRMVHTFCGGWMAFVRGNDIKIGDVCIFELISKLDMRVHITGVGRKEVDLESGK
LTSNESSTVDHPLF
Download sequence
Identical sequences V4SK70
XP_006434882.1.91645 XP_006434883.1.91645 clementine0.9_006512m|PACid:19274447 clementine0.9_006518m|PACid:19274448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]