SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_006783m|PACid:19278773 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_006783m|PACid:19278773
Domain Number 1 Region: 205-498
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.27e-96
Family Cryptochrome/photolyase FAD-binding domain 0.0000069
Further Details:      
 
Domain Number 2 Region: 4-191
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.57e-47
Family Cryptochrome/photolyase, N-terminal domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_006783m|PACid:19278773
Sequence length 543
Sequence
MSSGSASLMWFRKGLRIHDNPALEYASKGAKFVYPVFVIDPHYMEPDPTAFSPGSSRAGM
NRIRFLLESLVDLDLSLKKLGSRLLVFKGEPSEILIRCLQEWDVNKLCFEYDTDPYYQAL
DMKVKDYASTAGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKLAGQPLWASSPLPV
SLSSLPPVGDVGYFEISEVPTVEELGYKGYGQEELSPFRGGESEALKKLRESISDKEWVA
NFEKPKGDPSAYLKPATTVLSPYLKFGCLSSRYFYQCLTDVYQNVKKHTSPPVSLVGQLL
WRDFFYTVAFGTPNFDRMKGNRICKQIPWSNDDELLAAWREARTGYPWIDAIMVQLRKWG
WMHHLARHCVACFLTRGDMFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR
IYSPVSFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLTIQTRAKCIIGRDYPAPVV
SHDSASKECKRKLGEAYALNQKLNGQVSEDDLKNLRRKFEGEENQESGRRQKQKRLTDWL
KDH
Download sequence
Identical sequences V4RZB5
clementine0.9_006783m|PACid:19278773 XP_006427183.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]