SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_007701m|PACid:19279253 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_007701m|PACid:19279253
Domain Number 1 Region: 260-363
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.41e-16
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 56-177
Classification Level Classification E-value
Superfamily POZ domain 0.0000000011
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_007701m|PACid:19279253
Sequence length 514
Sequence
MVLDGIMENANEKSASLSFDSSYPTCWSTNQSTGTCDLDNLNLWMQSSNPKETWLEAEIV
VEGKSVAVNRSILSERSQFFRRLFNLRNDWKPKYLLTDLVPHGKVGYEAFNDTLHYIYTG
IRYAHDVCPPEVSTCVDDACAHVACRPAINYAIELMYASAAFQMTELVSEFQYWLMGMVG
KALAEDVIPILVAAFHCQLNMLRSYCIQRIAGSNLDNVCLEKELPDEVSSEIKSLRVKSN
QESEANIAEVDPMHAKIVRRIHKALDSDDVELLKLLLDVSNVTLDDAYALHYAAAYCSPK
VFKEVLNMDSAGLNLKDARGRAVLHVAARRNEPEVMVTLLSKGACASETTSDGQTAVAIC
RRMTRRKDYLEATKQGQGTNKDRLCIDVLEREMRRNSMSENLAMSSEVMDDDFQWKLNYL
EKKVAFVRLFPSEARVAMEIAGAVTATGLSALGQKGLSGNLKEIDLNETPSMQAKSRQLR
LLTLRKSAAISFFSSTTSFQQYPPSFLSHQLYSL
Download sequence
Identical sequences V4VD78
XP_006437094.1.91645 clementine0.9_007701m|PACid:19279253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]