SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_009454m|PACid:19274462 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_009454m|PACid:19274462
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-19
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 351-441
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-17
Family B3 DNA binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_009454m|PACid:19274462
Sequence length 467
Sequence
MGEACNECRSWEEEIYWNHFQCIHFIQYLHTGFDHQLAIPEKVARNLRKKLPVTVSLKAP
SGFTWVVGITTRDHTLYFSHGWPEFVKDHFLGENDILFFKYNGGSHFDVLMFDGQSQCEK
AVSYFVKKCGHTEHSNRRETRRKIRETSVEGIPNSSHCDVDITPPEKGSDDDINKIPVGQ
PIVTPASSKRIRRDDTSNEFVRSRRNSYFVKKRKHKDHGSVSQTKRRIGESCVEGIPNSS
DCDVDVTLPEKASNDEINKIPVGEPIVTLDSSKRIWRVDSSNELAHTRRSSRSKTVSTNF
AEMLKTKTGDEQTIINGNVALSPPFTSNRRPVTQDEKNNALLMAQAVSTTDSFTVVMRPT
HVYKRFYMAIPASWMSKYLTLENQDVILRLNEKTWITRFQFCKPRCSGGLSGGWKNFAVD
NHLDEFDVCVFGPDNPGTKPMVLNVSIFRVVNAVVPLTQVAPASLQL
Download sequence
Identical sequences A0A067H9F6 V4V7P7
orange1.1g042953m|PACid:18092742 XP_006434884.1.91645 clementine0.9_009454m|PACid:19274462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]