SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_009466m|PACid:19277065 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_009466m|PACid:19277065
Domain Number 1 Region: 160-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-30
Family B3 DNA binding domain 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_009466m|PACid:19277065
Sequence length 466
Sequence
MEFGSSSNSYSNRERLICEEDEMIGIDYEMGNIISNTGSNQAVKLHFSTTYASNSSSSPS
SASSHHHHHHHQYTTQTQQLLPLTTHHQNYNKQQQQPQMGSWLLGKTTTTTTAAELEDVS
NEEETAAPTKEQAIIMQETKDIIEEGEAEEDRVLISLEKEHMFDKVVTPSDVGKLNRLVI
PKQHAEKYFPLDSSSNEKGLLLNFEDRNGKPWRFRYSYWNSSQSYVMTKGWSRFVKDKKL
DAGDVVSFHRGVGDLAKGRLFIDWRRRSHPPAAAAASFSRHLPFYRSIPWNPLLMMRPPV
LPASMYSQSQINNNFYNRNSISLGGTGNNNNVLSTRTLGSILYLRSQLPAAPAIQQQPPP
PPPHTEIGMTKWQQHPIVFDSVPVVQGKATAKRLRLFGVNMDCPITESDDECHILSSSTS
IQHATMAIHDQPSQLSSSSQLSLYDATPLLPPFDFLNKGKASMSFD
Download sequence
Identical sequences V4TL84
XP_006439180.1.91645 clementine0.9_009466m|PACid:19277065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]