SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_010284m|PACid:19271821 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_010284m|PACid:19271821
Domain Number 1 Region: 75-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-22
Family B3 DNA binding domain 0.0046
Further Details:      
 
Weak hits

Sequence:  clementine0.9_010284m|PACid:19271821
Domain Number - Region: 377-434
Classification Level Classification E-value
Superfamily Tropomyosin 0.0252
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_010284m|PACid:19271821
Sequence length 444
Sequence
MEEQSEPETPLLQTTKIKRKKTAESKMKLTQGAFDSSKESKSRRKRAMIDDLYDHAKVNS
PVIERAEEVRANLAPSYPSFWKAMVKSNVSHGFWLHLPMRFCKFNMPKIDTVFIVENESG
EEYKINYISQRTALSGGWKAFSDANQLYEGDVLVFHLVEPTRFKAYIVRANGFGNVNADA
KPLNSVPMDDELEVAPKDHSEKRVKKNKRAKRVKPPPGFHRDNNQSNSLMLLETNNGHVE
DQFNNDTEDLGPNKVLPHSESSNFKEMKSIDDFTILVDGLAIDCELSDQHRNKYYDLCCS
QNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFELLGMN
VGFLRARLNRLMSLAFESEESEVSKRLREVSAEQARAEEEMRSLELKLLRLKETMGRLDS
EVESLKVKAEKHELKFQEEANAPW
Download sequence
Identical sequences V4RPG7
clementine0.9_010284m|PACid:19271821 XP_006423043.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]