SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for clementine0.9_011772m|PACid:19280654 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_011772m|PACid:19280654
Domain Number 1 Region: 271-373
Classification Level Classification E-value
Superfamily TAZ domain 1.26e-23
Family TAZ domain 0.00044
Further Details:      
 
Domain Number 2 Region: 74-193
Classification Level Classification E-value
Superfamily POZ domain 7.85e-16
Family BTB/POZ domain 0.017
Further Details:      
 
Weak hits

Sequence:  clementine0.9_011772m|PACid:19280654
Domain Number - Region: 9-92
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 0.0294
Family Ubiquitin activating enzymes (UBA) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_011772m|PACid:19280654
Sequence length 407
Sequence
MASPDIESPWLCAAGESFCGSFNIRVEEGNAADILHVLEVPTSSVTYNCSIPKPPPLPIK
PCTKNKYPNRFLHCSFVPKETKDVWDKLFKEGNGADVYIITMDESCIQAHSSILSIASPV
LGNILQQSKVKNGFKYIKIPGVPHEAVYAFFRFLYSSCFEEEDLKKFVLHLLVLSHSYLV
PPLKRVCEYFLEQGGLTKENVIDVLQLARNCDAPRLSLICVRMVVKDFKAITLTEGWKIM
KRANPALEQELVESVVDEDSRKQERLRKVEERKVYLQLHEAMEALLHICRDGCRTIGPRD
KVLKGSQVACNFPACKGLEALVRHFSNCKTRVPGGCVHCKRMWQLLELHSRMCNEPDLCK
VPLCRHFKEKMQQQSKKDEAKWKLLVSKVISAKKALGPFSARHAGLL
Download sequence
Identical sequences V4T559
clementine0.9_011772m|PACid:19280654 clementine0.9_011784m|PACid:19280655 XP_006442138.1.91645 XP_006442139.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]