SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_012015m|PACid:19265319 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_012015m|PACid:19265319
Domain Number 1 Region: 129-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-30
Family B3 DNA binding domain 0.0000165
Further Details:      
 
Weak hits

Sequence:  clementine0.9_012015m|PACid:19265319
Domain Number - Region: 251-322
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0432
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_012015m|PACid:19265319
Sequence length 401
Sequence
MMNFVQEEKGNSNNNNEEDQDEDHQKERIKLPFSVSSSSSSVSSSKYKAFVPHHHQNSWL
LGPIDSQEAATNFDNREDLMDLSLGNNNNNNEDQPHKHSGNINNANVANGTGSSTTGESS
GMYRSIEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDSSSNEKGLLLNFEDRNGKA
WRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDTVSFQRGVGELGKDRLYIDWRRRPDVH
HVPDPTTLAQMQFQNQLRFQQSLRWGTRLYSLPQSLSNYGPFSYNTIHNPYYQHHQQQQI
LGFGGNASSTMPVQYYLRPSSVSQQIEGGHMPMVIDSVPVVVPGKTASSTAAKRLRLFGV
NMDCPTQDDQSPATSSSSTRQAAASEYSSKGKSSLSFDLDL
Download sequence
Identical sequences A0A067H3S6 A0A2H5NY27 V4U6Y0
orange1.1g015743m|PACid:18135882 XP_006444696.1.91645 XP_006444697.1.91645 XP_006444698.1.91645 XP_006491400.1.29302 clementine0.9_012013m|PACid:19265318 clementine0.9_012015m|PACid:19265319 clementine0.9_012029m|PACid:19265317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]