SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_012751m|PACid:19252655 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_012751m|PACid:19252655
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-20
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 295-376
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-18
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_012751m|PACid:19252655
Sequence length 385
Sequence
MPRPYFHKLILASTIRDKRLRIPENFVRNFKDDLSAAATLIVPNGMVSRVGLRRLDNKVW
FYDGWQEFMERYFIRIGYFLVFRYEGNSAFNVYIFNLPSSEINYQPNALSNFEVPNHSKQ
YHIFAEMEDDDSEHVDQPTVNKTFNPPSFQNLLNSSKLSNSINGAGEANLQRLKVKLYSQ
DGETPKLKKPGRKRKIDPNVQASSAQEVHDGEMQFRFYESASARKRTVTAEERERAINAA
KAFEPSNPFCRVVLRPSYLYKGCIMVSCRISITLHCFSVSRDNMLDVRCIYFLLLQYLPS
CFAEKHLNGVCGFIKLQLSDGKQWPVRCLYRGGRAKFSQGWYEFTVENRLGEGDVCVFEV
LRAREFVLKVTVFRVSESAGFMSRH
Download sequence
Identical sequences V4SBZ3
XP_006423105.1.91645 clementine0.9_012751m|PACid:19252655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]