SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_013116m|PACid:19260019 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_013116m|PACid:19260019
Domain Number 1 Region: 206-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-30
Family B3 DNA binding domain 0.00000472
Further Details:      
 
Domain Number 2 Region: 69-125
Classification Level Classification E-value
Superfamily DNA-binding domain 7.19e-18
Family GCC-box binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_013116m|PACid:19260019
Sequence length 377
Sequence
MKREEMDGSCMDESTTTDSASTSPPITFPASIPPTKSPESLCRVGSGASSVILDSEAGVE
AESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARAYDIAAQRFRGRDA
VTNFKQMSCAGTSSDEGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKR
VIKHGEGDGVATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGST
SKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDR
QLYIDWKARTGPVENPVEPVQMMRLFGVNIFKIPGNGLVGVDKIGCNINNNNDGKRLREM
ELLSIECSKKQRMIGAS
Download sequence
Identical sequences V4VES5
XP_006437734.1.91645 clementine0.9_013116m|PACid:19260019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]