SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_014026m|PACid:19274455 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_014026m|PACid:19274455
Domain Number 1 Region: 172-270
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-23
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 6-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000412
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_014026m|PACid:19274455
Sequence length 358
Sequence
MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGELH
FTVQIFDQSGCEKEAAFNSKSTSTGQKREREEAVAHSDKALQSLLKKIRECSSSFESDCI
DDNRDREADSCEETRRCLSLSTIFASPSQPKTCNIKPEDEEKKVAQSFISAFPYFVRKMK
RFNVSGSYTLNIPYQFSMAHLPNFKTEVVLHNLKGASWTVNSVPTTKVHTSHTFCGGWLA
FVRGNEIKLGDICIFELVHKCELHVYILRVGKQYPDSQRGTTVLTGSNVSSTTISCKQFD
GVPKKVKKNSLKKIQLCNVKGSKSCEIKKHIGTDGNSVSIATCCLPKISHEKSGKAVN
Download sequence
Identical sequences V4T9C4
clementine0.9_014026m|PACid:19274455 clementine0.9_014032m|PACid:19274457 clementine0.9_014056m|PACid:19274456 XP_006434875.1.91645 XP_006434876.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]