SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_014064m|PACid:19262960 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_014064m|PACid:19262960
Domain Number 1 Region: 165-263
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-27
Family B3 DNA binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 43-100
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000641
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_014064m|PACid:19262960
Sequence length 358
Sequence
MEEEMLSIVSNGETNVIPELSDSISSTPLIPATKRFRHTSAVSKFKGVVPQQNGHWGAQI
YANHQRIWLGTFKSEKDAAMAYDSAAIRLRSVDSHRNFPWTKITIEEPNFQSHYSTEAVI
NMIRDGSYSSRFADFLRSHSRTLEEDVIFTQMRAGTDGWMMCRQLFQKELTPSDVGKLNR
LVIPKKYAVKYFPQISERVEEHAENDKADDVQLDFHDKSMKLWKFRYCYWKSSQSFVFTR
GWNRFVKENQLKANDTICFYLCELRDIAKGTKTFCMIDANKGENGGASAEVSGPYVDMKV
DLQLQLGQNIVDDKKENKVEEDDNGNEIEAAEEVELKVPSSTSDSERKLFKLFGVEIF
Download sequence
Identical sequences clementine0.9_014050m|PACid:19262961 clementine0.9_014064m|PACid:19262960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]