SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_014274m|PACid:19252656 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_014274m|PACid:19252656
Domain Number 1 Region: 245-346
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-24
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-20
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_014274m|PACid:19252656
Sequence length 354
Sequence
MPRPYFHKLILASTIRDKRLRIPENFVRNFKDDLSAAATLIVPNGMVSRVGLRRLDNKVW
FYDGWQEFMERYFIRIGYFLVFRYEGNSAFNVYIFNLPSSEINYQPNALSNFEVPNHSKQ
YHIFAEMEDDDSEHVDQPTVNKTFNPPSFQNLLNSSKLSNSINGAGEANLQRLKVKLYSQ
DGETPKLKKPGRKRKIDPNVQASSAQEVHDGEMQFRFYESASARKRTVTAEERERAINAA
KAFEPSNPFCRVVLRPSYLYKGCIMYLPSCFAEKHLNGVCGFIKLQLSDGKQWPVRCLYR
GGRAKFSQGWYEFTVENRLGEGDVCVFEVLRAREFVLKVTVFRVSESAGFMSRH
Download sequence
Identical sequences A0A067EE91 V4S7D7
XP_006423107.1.91645 XP_006479395.1.29302 clementine0.9_014274m|PACid:19252656 orange1.1g018533m|PACid:18096079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]