SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_015782m|PACid:19252711 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_015782m|PACid:19252711
Domain Number 1 Region: 13-95
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-21
Family B3 DNA binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 224-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.08e-18
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_015782m|PACid:19252711
Sequence length 324
Sequence
MAGGNRRAETSHFFKRIPRKFVKRFGDELSAVATLNVPNGRVWQVGLRKDGRKIWLQDGW
DNFAEYHSIAVGYFLVFKYAKNSTFDVLVFDMTACEIDYPYDYEETESEEGDEMETENSV
EILSFTKMNTPPVQQNQVKPGSKPEKKKIGGIKLETATNSREKKRCPTHGNEHGKLKKAA
YHEVETDSSDGDQVFEEMGIFMSEGHRYLSVEERQSLVTAVRLFKPQNPSFVDILRSKKR
YSYMYVPSKFSKKHLIRGTRSIKLQDSDGKEWPAQLTWSSGCGIKGGWPAFSKYKNLKQG
HVCVFELIKAKDILLKVSIHASSE
Download sequence
Identical sequences clementine0.9_015782m|PACid:19252711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]