SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_015967m|PACid:19252664 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_015967m|PACid:19252664
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-22
Family B3 DNA binding domain 0.00074
Further Details:      
 
Domain Number 2 Region: 209-304
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000049
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_015967m|PACid:19252664
Sequence length 321
Sequence
MAKCIPGFFKVYLPEKSSNRLHIPDAFIAHLSPSKPEKVMLINHIGEYWHVDVAYCDKGV
FFLDGWQKFVKDNSLETADILVLKYDGDCWFNVKIMGKSGIEKTESYKEDLWVEDEEEET
EEEEKGGEEAEEDCKDDCVFEFGDNDSAADKDYIEEEDDDDEMTAITSCRGRINIGKSKK
RAVAKAGGSKAVYDINLLEVDVGDYGLYPNPYFVSKAWAGTRKNYLHVPSHVLKDLGLKL
AKKITILDERGYSFHGQLDIWKDGRQGIKGWSAFCRAKKLKKDDICICEFTHSRKMQNTI
KVHIVQGVGSQSKAKRSRSKN
Download sequence
Identical sequences V4SH70
clementine0.9_015967m|PACid:19252664 XP_006423126.1.91645 XP_006479376.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]