SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_016234m|PACid:19278176 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_016234m|PACid:19278176
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-22
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 212-311
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000765
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_016234m|PACid:19278176
Sequence length 316
Sequence
MTERAAATWLFEQQWRKRLNPGADVSSPHFFKIIFPFVLAEKKLRIPRDFVKKFGHELSN
GAQLTVPDGSVWQVALTRKGKDIWFHYGWEDFVESYSISAGYFLFFSYEKNSTFHIIIFN
LDACEVDYLYVGEESMKDEQNSDPENEKSVEHVEQQSRKRKMEEVAEMDEPNSDNNFNLS
VVLKKMGIYVTPRYRRFSAEESKRAISFARIVQPKNSSFMVILEQHFKSCRDVYCPIKFA
AKFVKKDSKYVKVQISNEVKESIELQWKPKGGFFLTRGWAKISRVKNLKEGDICIFELIR
KQDLLFKLSVFHSMLE
Download sequence
Identical sequences V4SDP1
clementine0.9_016234m|PACid:19278176 XP_006423710.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]